SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19779 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19779
Domain Number 1 Region: 4-109
Classification Level Classification E-value
Superfamily POZ domain 1.31e-19
Family BTB/POZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19779
Sequence length 170
Comment (Caenorhabditis remanei)
Sequence
MSIYEKTFAKTDRTDAILIVQGKKLHVEKALLSYHSAHFNALFNAEFKEKSMAEIPIEDV
NFKEFATLLSLFQRNPIVPTENNAEKLLELADRFLITSVKRQLELFLISTKIDNLEKIRI
AEKYELDDLMTRAAQWYNRREEFKEMKERIEYQQLKDSTKVKLFYRFLKI
Download sequence
Identical sequences E3MTA0
31234.CRE19779 CRE19779 XP_003100477.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]