SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19783
Domain Number 1 Region: 7-111
Classification Level Classification E-value
Superfamily POZ domain 2.83e-21
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19783
Sequence length 177
Comment (Caenorhabditis remanei)
Sequence
MSVTQELSIFESTFAQSDKTDAILVVGEKKLHVNKALLSYHSTYFNTLFNGEFKEKSMPE
IPIEDVKLEDFAALLSFIQENPITPKAPQAEVLLQLADRFLLAAAKRHVEMLIAMTPKIN
LITKLQLADKYNSDVLLKNTLAKLKTKRDFAAVYKTTVGFSDKTKARIYDAYFSKFL
Download sequence
Identical sequences E3MTA4
CRE19783 31234.CRE19783 XP_003100478.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]