SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19785
Domain Number 1 Region: 9-72
Classification Level Classification E-value
Superfamily POZ domain 2.15e-17
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19785
Sequence length 88
Comment (Caenorhabditis remanei)
Sequence
MSINESTFAPSNKTDAILMVEGKKLHVNKALLSYHSDYFNTLFNGEFKEKSMPEIPIEDV
KYEDFATLLSFIQENPILPKSVVKSIRT
Download sequence
Identical sequences E3MTB0
XP_003100510.1.11157 31234.CRE19785 CRE19785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]