SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19790
Domain Number 1 Region: 9-137
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000942
Family BTB/POZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19790
Sequence length 162
Comment (Caenorhabditis remanei)
Sequence
MGDNIPINVYESMFAKSESTDVCLIIKEDESQPAKKSRKLTASSDVTTSPVLTRKMYVNR
ATLSKRSTVFEGMFAASPDSTEFTINDAKYDELTAVLSVTEPTPIDPTEENVEGILRLAD
RFMLLDATRYVESFISRSGWDEKKKNELSKKFNLKNLSQRRD
Download sequence
Identical sequences E3MTB6
31234.CRE19790 CRE19790 XP_003100526.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]