SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19792 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19792
Domain Number 1 Region: 8-113
Classification Level Classification E-value
Superfamily POZ domain 5.1e-23
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19792
Sequence length 180
Comment (Caenorhabditis remanei)
Sequence
MSATPAVSIYESTFASSDKTDAILVVDGKKLHVNKALLSYHSDYFNTLFNGEFKEKSMPE
IPIEDVYFEDFATLLSLLQHNPIEITNGNAESLLELADRFLLPGPKSQVKHFIWMSPGFS
RFNKLKLADKYKMDVLLERMIALYTHRSHFSDLCYKKNKEISLELQLRMYDLFFEKYFHS
Download sequence
Identical sequences E3MTB8
CRE19792 XP_003100570.1.11157 31234.CRE19792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]