SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19794 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19794
Domain Number 1 Region: 9-114
Classification Level Classification E-value
Superfamily POZ domain 1e-22
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19794
Sequence length 180
Comment (Caenorhabditis remanei)
Sequence
MSETPEISVYESTFAQSNKTDAILVVDGKKLHVNKTLLSYHSNYFNTLFNGEFKEKSMTE
IAIEDVNFYIFATLLSLLQHNPIEITRWNSANLLKLADRFLLPYPKSLVENFIWTSSEFE
RIDKLKLADKYKLDSLLERVIALYTRPADFSELSYNRNKDISEKLQLRMAKLYFGMYFNS
Download sequence
Identical sequences E3MTC0
CRE19794 31234.CRE19794 XP_003100577.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]