SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19914 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19914
Domain Number 1 Region: 9-61
Classification Level Classification E-value
Superfamily POZ domain 0.00000000471
Family BTB/POZ domain 0.0045
Further Details:      
 
Weak hits

Sequence:  31234.CRE19914
Domain Number - Region: 74-101
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.051
Family Skp1 dimerisation domain-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19914
Sequence length 144
Comment (Caenorhabditis remanei)
Sequence
MSSFPTSHHTLKSNDGREVLISTRAIQQLTTLNNSTETYIHFPNINGATLQLIAEWFETQ
EDTQKYIDFSEKIKGLDVYDLLIAANSMGVKTLIDYLFNFMIKKAVVVSEVVSEKMKTDG
DKDAIERAIHESINNDNQFSVDII
Download sequence
Identical sequences E3N2Y8
CRE19914 31234.CRE19914 XP_003097240.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]