SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20208
Domain Number 1 Region: 286-401
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.87e-16
Family Calponin-homology domain, CH-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20208
Sequence length 477
Comment (Caenorhabditis remanei)
Sequence
MNRFTGMSSKPITPVNEQNITFRKKISMVSTSLQGSDDQPVASSPRNCYYRQNVAPLRRH
MYDEADGGAISTSEQTPIEQKATEIRRMNNKKEASGKKEETPAPPTILIEGPSSEASSKS
NQKKTKPSTSSLASVFRSRASSPMEAVRKVFGRSSSKQPKELPAPPSSLISVSSAPTGTE
TNLTEELEKLRNQLAHAHNQIAEQTKKQNVVQMVSCSQQTDLINSATVTTMTDVYEETKK
EESPDKENVHPDIICLEDDENNSSRIQSLLKELSLLKVIRNEQLSSHNKKLACFQKENNE
LKEDFRRTRKDFILILKEAVIRKDEAERELDIISKSICNEDDWDSLMSQQTHALRRNVLL
MWVQKKLALYSDQLTVSNFSSDWADCRAFCALLYDIFPEAMSDVYVSPIVGDCVTRCRRT
FQRLEIPFDERALGISTTPSSGVDDDSTSGMTITGLIDWRYIMNTVLVLYKKDVHGK
Download sequence
Identical sequences E3MCN2
CRE20208 XP_003106079.1.11157 31234.CRE20208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]