SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20425
Domain Number 1 Region: 208-331
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-33
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20425
Sequence length 476
Comment (Caenorhabditis remanei)
Sequence
MPSCTTPTFGVTSQLETQNAESPSRSSILTPTSLEDETSPRKRFPLIETNISASDRWPPA
PRRDGWSSVRAPPPARLSLHTNHRSMLSPISSAYSQTPNSLLSPTMFHPKTRSIFSPTLP
STPMSYGKSSMDKSLFSPTTTEPVEAEATVEYLAELVKEKKHLTLFPHMFVNVERLLDDE
IGRVRVALFQTEFPRVDLPEPAGDMVSITEKIYVPKNDYPDYNFVGRILGPRGMTAKQLE
QDTGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHLKLQAALEQ
VKKLLVPAPEGTDELKRKQLMELAIINGTYRPMKSPNPARMMTAVPLLSPTPIRSPGPVM
LSPTGTGVPTSTFGGSILFSSFQSPTLAGSNGMLGSNIFDYNLLSPSMFDSFSSLQLASD
LAFPKYPTTTSFVNSFPGLFTSASSTNSQNTTINNTQNMSPIPSSQSASSVNNTSF
Download sequence
Identical sequences E3MT54
CRE20425 XP_003100676.1.11157 31234.CRE20425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]