SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE20485 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE20485
Domain Number 1 Region: 5-83
Classification Level Classification E-value
Superfamily PapD-like 3.14e-23
Family MSP-like 0.00000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE20485
Sequence length 154
Comment (Caenorhabditis remanei)
Sequence
MAQSVPPGDIQTQPNAKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC
GVLDPKEAVLLAVSCDAFAFGQEVSYSEIEGIPDPNSLHFRTLTTTVSPSSGPTLQMAQP
SSSVVSGSKEMVWFVVRTSRSSTTLESGRTMPNS
Download sequence
Identical sequences E3N2U0
XP_003097298.1.11157 31234.CRE20485 CRE20485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]