SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21053 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21053
Domain Number 1 Region: 86-138,171-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.88e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21053
Sequence length 249
Comment (Caenorhabditis remanei)
Sequence
MAMMTSQYSGNQASGDHNNNNLSSSESGVELKSLLSLIDNVYEMSPPTSDNQVNTDSESC
YQFQSRFKMSRIPPSGEFSIPGYVTMSETLLVPVKKYPKYNFVGRILGPRGMTVKQLEKE
TGCKIFVRGRASSLAANPVVKSKNRQSGPNNYNPLLNPNQCAKPSLSNISKCALTEEPLH
VFIECYNTPSVAEQKMIEAVEILQDLLSPPVDGKDELKRQQLVDISLINGTYRATSASND
YVRKLRSLG
Download sequence
Identical sequences E3NPN0
XP_003089641.1.11157 31234.CRE21053 CRE21053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]