SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21079 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21079
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily POZ domain 3.06e-20
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21079
Sequence length 124
Comment (Caenorhabditis remanei)
Sequence
MSIYEKAFPSSAKTDAILVVDGKKLHVNKAFLSCNSDYFNSLFNSEFGEKSMAEIPIREV
EFEDFATLLSLVHPTPIKPTKDQFEKLIELSDRFMLPGAKNRLESFMVTSCSAVIKLYWA
ESTD
Download sequence
Identical sequences E3NS50
CRE21079 XP_003088772.1.11157 31234.CRE21079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]