SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21187 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE21187
Domain Number - Region: 66-122
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.085
Family Kix domain of CBP (creb binding protein) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21187
Sequence length 243
Comment (Caenorhabditis remanei)
Sequence
MEGDYIDEDFVVQEKISEKPAETLETVENPEKLFEKPEKDGVSEPKGRFKWTPHTFKMGK
LRWQMRMMIRDRMEQVDKIIDAFYCTKTNIRHRRFDELMWFARRLEETLFHKSSKFEIYE
KGIQTIVTLMNVLMQADPAMRHLIDENEIPSTEQLEKLFTLKAERHELIEDDYLEDGVAE
IELIKEDRFRHTDLILDREPPADMIMLNLHSGSRIFAETRPSSVQYSKIRVDLRRKSTLL
WHS
Download sequence
Identical sequences E3MF99
31234.CRE21187 XP_003105181.1.11157 CRE21187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]