SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21300 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21300
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily POZ domain 1.24e-27
Family Tetramerization domain of potassium channels 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21300
Sequence length 225
Comment (Caenorhabditis remanei)
Sequence
MCSPNNTVKLNVGGTTFQSTHSTLTKFDGYFKTMLETLVPVEKDELGYIFIDRDPTHFRL
ILNFMRDGDVGLPDSEQDVEEISREANFYLLEGLMELCSRKLEILAPKNALKIRILETDE
QVLQATVYAEKPVLIIYFVVGSHGEILKPFYQQERFNIFGYLEKYETEFDIYFRKKYLDD
GICSFQIRYKNEVVTRQNFPPNIRNFDIKIQECIEKIERLKSYNS
Download sequence
Identical sequences E3MUK6
31234.CRE21300 XP_003100109.1.11157 CRE21300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]