SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21309 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21309
Domain Number 1 Region: 10-105
Classification Level Classification E-value
Superfamily POZ domain 0.0000000267
Family BTB/POZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21309
Sequence length 171
Comment (Caenorhabditis remanei)
Sequence
MGAPNQYDKPTDTTDVILIVGSRKFYLSRQWFTDRVPVLVLMHQDPRMEIWIGCERAGPE
LFLGFLHCLDRLDVINEDNAIGILRWAERFECKIVLDQIEQFFLNSSQKNATEKLKIAME
YKFLELQRQILNNIKSAEEFWETLPVSLTEQQKIEIARMVHEHSERESGGS
Download sequence
Identical sequences E3MUL7
CRE21309 31234.CRE21309 XP_003100106.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]