SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21348
Domain Number 1 Region: 136-237
Classification Level Classification E-value
Superfamily POZ domain 4.71e-28
Family BTB/POZ domain 0.0081
Further Details:      
 
Domain Number 2 Region: 20-128
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000196
Family MATH domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21348
Sequence length 299
Comment (Caenorhabditis remanei)
Sequence
MSTDKVFQMKHVFVDLLNMEKEKYHYLPTEIHFNIPWKLGVYVYGSDALFYLHCDKFHGI
EEWSIDTNIVMNIRKIFGENDSISVDRIFSQHCGSNGHIKFFSLGEMDSYLINGNVTIEA
NVTINGMKGIKETFRKFNESEFSDVVLIAGDQKFHVIKMYLAAHSTYFNALFHGNFKESG
NPEIELKDVDPYDLQHFLEVLYGESSIDNDTVTGILKLGDMYDARTAIRRCEEFLLEKSK
HPLKMKFISAVRYNMDRLKEKCLSEMNTVAEIVDVVPEDADQFCPTVWKELFLKAYSSH
Download sequence
Identical sequences E3MUV9
31234.CRE21348 CRE21348 XP_003100086.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]