SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21349 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21349
Domain Number 1 Region: 145-209
Classification Level Classification E-value
Superfamily POZ domain 3.92e-16
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 7-126
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000000128
Family MATH domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21349
Sequence length 215
Comment (Caenorhabditis remanei)
Sequence
MTAPAKEFVMRHIFKNVSSLKEGEEQSSFVEEHFNVPWKTKVGRKDEFLFYCLYCDQPKT
ADWLITIEREVRLISIGGKTEKRNSELTYKSKSNYTGWGFNLIKWEDMEKNYMVDGDIMI
ETYVKIKKMTGIERKKLRNFDESMSEFSDAVLIVEDEKFYVSKLFLASQSSYFKSILMGK
QEESEILEVTLENCKSKDFQYFLELIYGESPIDGS
Download sequence
Identical sequences E3MUW0
XP_003100115.1.11157 31234.CRE21349 CRE21349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]