SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21352 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21352
Domain Number 1 Region: 20-119
Classification Level Classification E-value
Superfamily POZ domain 1.26e-24
Family BTB/POZ domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21352
Sequence length 181
Comment (Caenorhabditis remanei)
Sequence
MVREHRGFLRKKLKNFDATMEEFSDLAIVVEDEKFHISKLFLSDQSTYFKSLLTRNQEES
GKPEITLDDCKSEDFQYFLELIYGESPINKETIDKIVHLADKYKAPSAIRKCEEFLINNS
GKTLKEKLQMAKKYKLENLKTACLSKIKTVEEIRSVLSYTTSEMDPSVVGALLQKSLSLL
P
Download sequence
Identical sequences E3MUW3
XP_003100149.1.11157 31234.CRE21352 CRE21352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]