SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE21430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE21430
Domain Number 1 Region: 131-228
Classification Level Classification E-value
Superfamily POZ domain 2.32e-19
Family BTB/POZ domain 0.024
Further Details:      
 
Domain Number 2 Region: 28-121
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000872
Family MATH domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE21430
Sequence length 290
Comment (Caenorhabditis remanei)
Sequence
MPVPEEKEFVMRHCFSSCYTDEFGPKEIRYNIPWSMQLYCKRHCLEAYLFCWKEGSGWSI
DADYEVKCVGKRKSFGVKGTARFDGYESFANHMLPFAKANSHLVNDKLKVEWRIKINKMT
GFDEEDSSGNKENDDIVLKVKEEKFEVDKKFLAENSTYFNNLFFKCSDESGKPEIQLEDV
DPQEFKTFLKVLREEEPIGDETVEEILKLADKYDSKNALKRCEEFLIDKSKKPLKMKFNA
AIQFKLNKLKKKCMSNMESKEDIQEIAEEDARHFNASVWKELLQKALSLD
Download sequence
Identical sequences E3MUX7
CRE21430 XP_003100137.1.11157 31234.CRE21430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]