SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE22363 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE22363
Domain Number 1 Region: 94-220
Classification Level Classification E-value
Superfamily SET domain 0.000000000000262
Family Viral histone H3 Lysine 27 Methyltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE22363
Sequence length 222
Comment (Caenorhabditis remanei)
Sequence
MSVPTNSNYLLVVESCSLKIIKREDMSNQYQEIHPITDEEYQKTGKPIPTNKYNEETDIW
CPHCSKYYWKFCRRHPLYLVPNGSIEDGPEDKSRAMRSVPQEFVEVATSSLKGAGKGVFA
RKLLPKGYMFGPYEGERVEDSSQMKTPGYSYELDGKDGPYLIDASDENASNWLRYVNAPN
KKEHQNLYAVQHNHQIYYIVTKAIFIGEELLVPYGPKYWRGK
Download sequence
Identical sequences E3MEB8
XP_003105602.1.11157 CRE22363 31234.CRE22363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]