SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE24012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE24012
Domain Number 1 Region: 18-140
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.06e-33
Family Calponin-homology domain, CH-domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE24012
Sequence length 141
Comment (Caenorhabditis remanei)
Sequence
MANRTTAGGIGFAVRQKQESKFIKEEAALLLEWIKKVSGENISTSGERDNFHNLLKDGTL
LCKLANGLEAGSVKKVQKPISTFACMENINAFVEFAKKQGVPNEETFQSVELTEGRDLFS
VCITLLSLGRILQKAGKSHPF
Download sequence
Identical sequences E3MGG6
XP_003104874.1.11157 31234.CRE24012 CRE24012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]