SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE26722 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE26722
Domain Number 1 Region: 113-179
Classification Level Classification E-value
Superfamily POZ domain 1.99e-18
Family BTB/POZ domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE26722
Sequence length 221
Comment (Caenorhabditis remanei)
Sequence
MGYTEKFMISHTFQNVEHGKLGGYSGPRKTINEQNCYIFCMKTNESNWHCCLNGVETVGT
TDGRIENSPGITLQDDPKYFVNGNMRVECYVEVYEVDENGIRIPPRLFDESVKEYSDVVL
IVEEKKFYVNKLYLASESSFFKYLFIGSFEESKKDEISLKDVEAKYFQLFLESLYGDPVI
NGILPESDQNCGRYSCCNVRESQGNGSRRVGIPFSKSSFSS
Download sequence
Identical sequences E3MXV5
31234.CRE26722 XP_003099021.1.11157 CRE26722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]