SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE28808 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE28808
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000062
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE28808
Sequence length 157
Comment (Caenorhabditis remanei)
Sequence
MPNTSAGMVIGKHRTTIKLFPKHFGCQIQVFPKSVEAKAALERVVTVAHEDSAILLGAVR
RVLQKVALDPHHCSEIKDEDFKDNKNSQIVRSPVKVEEIEEMKPFLCTKSEKMCFNRLKE
EYMLTGEIGGCPTPVSDHPTADDIRQWAIGYEAIRKY
Download sequence
Identical sequences E3MK73
CRE28808 31234.CRE28808 XP_003103474.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]