SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE29006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE29006
Domain Number 1 Region: 16-94
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000541
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE29006
Sequence length 204
Comment (Caenorhabditis remanei)
Sequence
MGIDESTFARSDKTDVLSYHSDYFDTLFNGDFMEKSMPEISIEDVNFEDFAAVLSLILKN
PISPTEENAEKLLELSDRFLLPAAKRHVEFFLISTGFDAFKKLETASKYDLDTLLSHALS
LFKTKEELIPSEEFSEFPEKVKAKILDRLIELNKLGLTGPSEFESSSFVGFRSVIGDRLN
SQARSRASWSLRDSTSEREFEEDW
Download sequence
Identical sequences E3N5G1
CRE29006 XP_003096384.1.11157 31234.CRE29006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]