SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE29020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE29020
Domain Number 1 Region: 171-294
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000127
Family C-type lectin domain 0.0092
Further Details:      
 
Weak hits

Sequence:  31234.CRE29020
Domain Number - Region: 56-173
Classification Level Classification E-value
Superfamily Nucleoporin domain 0.0811
Family Nucleoporin domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE29020
Sequence length 298
Comment (Caenorhabditis remanei)
Sequence
MVLSVNMKFVKFIFLATIGCVIGQQKMMKIFGKVLDVDLDEVTIGLEPVSNFKCVDDCFQ
TDGCILVFMNSGGKCFSFDFNSTKKLTVVETKREEGLMVAFKTRFLLDQCPAYDDMDLVV
TVGVDPIPWIKNGNEYTFKKCDLHHKMFKRKNGVVVCMQLYTVGNDTESVVNSMENAKKK
CMKERKYQLTGVQSKEELQWIFGEYKIRSDENVGIWINARRQNEYSGMNDTHFNITDGYT
TLDQEFYRNFADLSGISDAGIPEDCLMVSKASPGFLMNDVPCDNNDYAKVYACGYLLV
Download sequence
Identical sequences E3NA53
31234.CRE29020 CRE29020 XP_003094715.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]