SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE29640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE29640
Domain Number 1 Region: 640-714
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00029
Further Details:      
 
Domain Number 2 Region: 370-439
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000136
Family Eukaryotic type KH-domain (KH-domain type I) 0.00091
Further Details:      
 
Domain Number 3 Region: 436-526
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000687
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Weak hits

Sequence:  31234.CRE29640
Domain Number - Region: 8-296
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000201
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE29640
Sequence length 721
Comment (Caenorhabditis remanei)
Sequence
MSDSDTDRMYIDCDFSYDPKIEIMKFILQFIYLVMGIALNLVVLRTLVWKRRDIFMTNSF
FVLFAVDCVINTVIMIVEGILPRFFIYVTPLCPLLSEYFSTPLFGFKIVMILSHHAIISK
SIMQSFLVLNRMTCVILPIAHDFIWRENIKFVILFVVLCPLSVDWNLAISRVYMQSTYGG
FWVNYMKKVQWASQSRFQLAFITIALFFTFICTTITLIKLPKRSKEIEKSITNATLIISI
IFTCKVLFQIYYSFFYHHADSSSAIYGLSFLALDFSAIGSPIIMICVSSALRKHLFSNNR
IDTTNVSKLQSRTSGIVVETSTMMIKVGAAAVGIDSPKAMKREHDNDDADRTGRHKRPKT
DGFTEAIQQGKFEVRLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPERVCTVT
ADEKTVLNILRDVLPRLEDNFSERDPCEVRMLIHQSHAGALIGRNGTKIKELREKCSARL
KIFTGCAPGSTDRVLITSGEQKNVLAIIEEVMKELKEIPIKGSSTPYLPSFHYDPSNISE
YGGFPGNLSSGGPQNSRGPAPPRGGQGPAGGQRSYGGGAITPGGGPRSFESGDFQQFRGG
PMPGYAMNAPGYAPQQGQFGAPANAGYGYGPGGGGPVTTAQVSFVTIPSDLGGTIIGRGG
ERIARIRQESGAQITLEPSTGQPERIITIKGTEPQIHSAQYLLQQCVRNSTQGRERFGGN
V
Download sequence
Identical sequences E3LUY2
CRE29640 XP_003112105.1.11157 31234.CRE29640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]