SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE30369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE30369
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily POZ domain 7.65e-16
Family Tetramerization domain of potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE30369
Sequence length 190
Comment (Caenorhabditis remanei)
Sequence
MFRAMFETEIPLEREENECIFIDRDVKHFRLILNFLRDGHIILPDSETEIEEIYKESSYY
LLDGLMQLCQERCNDDRQLKEMRHIENKTELLKTVLHSRKAFLIFFYEPENVVRVENFFN
EGVFPATIVHLKKFIAEFESKFDFYYTAGGSEEGWSCVHYKDYNSTFIAAHSWSRDFLDD
IRMSLKDKEL
Download sequence
Identical sequences E3N611
XP_003096171.1.11157 31234.CRE30369 CRE30369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]