SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE31226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE31226
Domain Number 1 Region: 68-144
Classification Level Classification E-value
Superfamily HMG-box 4.58e-17
Family HMG-box 0.0016
Further Details:      
 
Domain Number 2 Region: 145-216
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000393
Family HMG-box 0.0029
Further Details:      
 
Domain Number 3 Region: 11-66
Classification Level Classification E-value
Superfamily HMG-box 0.000000000109
Family HMG-box 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE31226
Sequence length 333
Comment (Caenorhabditis remanei)
Sequence
MSIIPDFHELSKTQYMLFRDAKHPQLAEQYPDLTDEELVELVASLWEEATPEEKAFYSSE
AARLKALQKKFYGHLKRPRSAYTIWSNENCIDLFNQNPTANARVITKKLGIMWNDMSDEE
KTPYFQQEEMEKAVFNAAVESIKNNNKTEEKKPIKGPKTSYNIFYSFKKNELEKENLSIE
KTKMAEEINKTWRNMSDAEKAPFRVQAMQLKKEYNKISANQNSQSLRMAKKRKADVANQD
AITLSPSLSTDSEVEREDNQTPSVRLLECSFSNLGIDDGELEQLENIEPTVKMPDDFPWE
KKKTDLIFQERIVDYADYQDSQSHLLLENYFFF
Download sequence
Identical sequences E3MLP2
31234.CRE31226 CRE31226 XP_003102938.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]