SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 313596.RB2501_08650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  313596.RB2501_08650
Domain Number 1 Region: 180-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6e-16
Family Mevalonate kinase 0.095
Further Details:      
 
Domain Number 2 Region: 9-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000011
Family GHMP Kinase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 313596.RB2501_08650
Sequence length 311
Comment (Robiginitalea biformata HTCC2501)
Sequence
MKGPLFYSKILLFGEYGIIKDSRGLSIPYNFFKGALKTADPLKGAARESNENLRRFATYL
ETVSREFPDTGFDLDRLRDDLDAGLYFDSSIPQGYGVGSSGALVAAIYDRYARNKVTILE
NLTREKLLDLKGIFGRMESFFHGKSSGLDPLNSYLSLPILINSRDHIESTSIPSQNPGGK
GAVFLLDSGSVGETAPMVQIFMEKMKHEGFRSVIRDEFVRYTDACVEDFISGNVKSLFGN
IKKLSHVVLDHFKPMIPQEFHQLWKQGIETNAYYLKLCGSGGGGYILGFTEDLDKAKKAL
KGHRLEVVYNF
Download sequence
Identical sequences A4CJ50
WP_015753714.1.95753 313596.RB2501_08650 gi|260061657|ref|YP_003194737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]