SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 314275.MADE_00055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314275.MADE_00055
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 1.55e-29
Family Ribosomal protein L28 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 314275.MADE_00055
Sequence length 78
Comment (Alteromonas macleodii Deep ecotype )
Sequence
MSRVCQVTGKRPTVGNNRSHARNATRRRFLPNLQTHRFWVESESRFVKLRLSAKGMRIID
KKGIDSVLTDIRARGEKI
Download sequence
Identical sequences A0A010PKU0 A0A0B3XZD1 A0A1J0RNZ6 A0A1J0RZ52 B4S2C3 S5A9Z8 S5C3K3
gi|522612310|ref|YP_008178000.1| gi|522666021|ref|YP_008194483.1| gi|522813820|ref|YP_008182049.1| gi|566716615|ref|YP_008916937.1| gi|522567691|ref|YP_008170120.1| gi|522588127|ref|YP_008174204.1| 314275.MADE_00055 gi|522648667|ref|YP_008191130.1| WP_012516576.1.13129 WP_012516576.1.17455 WP_012516576.1.21115 WP_012516576.1.24997 WP_012516576.1.30323 WP_012516576.1.34434 WP_012516576.1.35093 WP_012516576.1.36926 WP_012516576.1.48123 WP_012516576.1.50651 WP_012516576.1.52576 WP_012516576.1.68468 WP_012516576.1.81623 WP_012516576.1.96561 gi|410859705|ref|YP_006974939.1| gi|332139462|ref|YP_004425200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]