SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 314315.LSA0334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  314315.LSA0334
Domain Number - Region: 30-104
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.00222
Family Chemotaxis phosphatase CheZ 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 314315.LSA0334
Sequence length 114
Comment (Lactobacillus sakei 23K)
Sequence
MKMRYKILIGVGVTAGVGATAAFVGSKAIIEKVERYRKRLAVKNFVKDKLHGNQKALELV
DQLSDADVNNLLGAADKLNQLKDKLGEQTDNIPEMMEDLRQTLTAYATKVKERL
Download sequence
Identical sequences A0A221MWF8 Q38YU2
gi|81427948|ref|YP_394947.1| 314315.LSA0334 WP_011374043.1.13714 WP_011374043.1.15890 WP_011374043.1.17502 WP_011374043.1.42590 WP_011374043.1.97777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]