SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 314315.LSA1266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314315.LSA1266
Domain Number 1 Region: 5-77
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0000000000327
Family GIY-YIG endonuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 314315.LSA1266
Sequence length 91
Comment (Lactobacillus sakei 23K)
Sequence
MTEKAYYFYVLVCADRSFYGGFTTDVTKRAATHNAGKGAKYTKLRRPVRLLYYETFADKS
SALKAEYAFKHQSRLKKERYLIAHGIESTQF
Download sequence
Identical sequences Q38W63
WP_011374963.1.13714 WP_011374963.1.42590 gi|81428877|ref|YP_395877.1| 314315.LSA1266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]