SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 314724.BT0018 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314724.BT0018
Domain Number 1 Region: 78-305
Classification Level Classification E-value
Superfamily Pseudouridine synthase 9.44e-63
Family Pseudouridine synthase RsuA/RluD 0.0000353
Further Details:      
 
Weak hits

Sequence:  314724.BT0018
Domain Number - Region: 30-99
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0997
Family Eukaryotic proteases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 314724.BT0018
Sequence length 326
Comment (Borrelia turicatae 91E135)
Sequence
MKKFQKEFIVRKDSQRLDIYLSEDLCLFTRSQIKKREVKAFKYHDGVFVAIKLSRPVFVD
DKILIEFNEEINLREYVRPLNLPISILYEDINVIVVDKPQGILSHPGISNLENTIVNFLL
YHISGLRDSFQEDKLRPGIVHRLDKETSGVMICAKNLKTLNFLSRQFKERFVKKVYIAVV
KGNFKIDSGIIETFIDRDRHDRKRFSVHENRGKRALTEYRVLASIGNYSLVALKPKTGRT
HQLRVHMKHLNHPILGDSIYARLDKEFKEMSLMLHAFKLEINIKEGSLKKFISVFPQRFI
NFLSIFYDKETLSILVNDFIVFLDKF
Download sequence
Identical sequences A0A172XAJ3 A1QYH1
gi|119952824|ref|YP_945033.1| WP_011771982.1.18561 314724.BT0018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]