SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315456.RF_0721 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315456.RF_0721
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-46
Family Ribonuclease PH domain 1-like 0.0000636
Further Details:      
 
Domain Number 2 Region: 294-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-43
Family Ribonuclease PH domain 1-like 0.0000247
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-27
Family Ribonuclease PH domain 2-like 0.0000925
Further Details:      
 
Domain Number 4 Region: 149-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.06e-24
Family Ribonuclease PH domain 2-like 0.0028
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.25e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 621-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.77e-18
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000178
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315456.RF_0721
Sequence length 747
Comment (Rickettsia felis URRWXCal2)
Sequence
MFNEITKSVTWNGKVLELSTGKIARQADGAVTVKMGNSVLLCTAVVAKKAKEGIGFFPLT
INYREMAYATGKIPGGFFKREGKASDREVLVSRLIDRPIRPLFHPAFVNETHVTCSVLSY
DPETPVDILAIIGASAALSLSPAPYLEIVAASKVGLINGEFVLNPTLELLKTSQLDLVVA
GTSDSVMMVESEAHLLAEEQMLEAVKFGFESFQPVIKIIKELAEEAKKPKLEMQDLYPAS
LKKEIEKLFVKEIEQAFAIKSKQERSTNLDLIPEKVLTHFVSDIENKKYSNYQIESALKS
IESDILRNEILEKNRRIDGRSTTDIRQIACEIGLLPSAHGSALFTRGETQSLVSTTFGTS
LDEQIVDSLEGEYKERFMLNYIFPPYSVNEAMPMKAPSRREVGHGKLAWRAINPILPNKV
QFPYSIRVVAETTESNGSSSMATVCGSSLALMYAGVPIKAPVAGIAMGLVKEGKKFAVLS
DILGDEDYFGDMDFKVAGTSEGITALQMDIKISGVDFKIMTVALEQARLGRLHILEQMNK
VISKPNSELSKNAPSTTTIKIDKDKIRDIIGPGGKVIKEICETSGAKIDISDDGSVSVYA
SDRDKLKVALDKIKAIAVEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISEERI
ETVSSVLKQGDIVKVKLIGFDNKGKAKLTIKNADKDKSSNNPKPKNNVNNAKENSEPERR
DSSKKRAWNEDSNNDKEEAITERKYFN
Download sequence
Identical sequences A0A0F3MSY5 Q4ULK1
WP_011271051.1.40963 WP_011271051.1.61726 WP_011271051.1.65220 315456.RF_0721 gi|67459113|ref|YP_246737.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]