SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315456.RF_0903 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  315456.RF_0903
Domain Number - Region: 27-62
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0994
Family GIY-YIG endonuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315456.RF_0903
Sequence length 185
Comment (Rickettsia felis URRWXCal2)
Sequence
MTKQSQEYYFMSLPPRFAPRNDGPGIHAGNAYAGMISNAFKRLSKYYRKYKSNLVMTIRK
FHYLTLLITIIAICSLFSIKERVSTLDYQLSSVVKQINSENNNIHILKAEQAYLLLPARL
EKLAAAYLKLETVKSYQMIKDPLGPNIDQNIKFNHNISISKSSKWRYKRITNNKYIQTVS
SRTKH
Download sequence
Identical sequences Q4UL19
gi|67459295|ref|YP_246919.1| 315456.RF_0903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]