SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315456.RF_1384 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315456.RF_1384
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 1.15e-49
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000106
Further Details:      
 
Domain Number 2 Region: 174-242
Classification Level Classification E-value
Superfamily PGBD-like 6.87e-18
Family Peptidoglycan binding domain, PGBD 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 315456.RF_1384
Sequence length 248
Comment (Rickettsia felis URRWXCal2)
Sequence
MIVIDKTSYRAVGFDKRIKFLVLHYTQCDFKQSLDFLTGEKLSSHYLINNENPEHIFQLV
EEHDRARHAGVSYWQGHERINDTSIGIEIVNPAFKVNAKNNNITWLPYSKQQINSVISLC
KQIIARYDIKPTRVVGHSDIAPGRKQDPGPLFPWKLLYDSDIGAWYDEQIFNKLLPQVDI
TDIKAIQQKFITYGYKLEATGILDSKMKDVIISFQIHFRPSNFSGDLDAETIAILDALIL
KYKSELSN
Download sequence
Identical sequences A0A0F3MS35 Q4UJQ4
WP_011271684.1.40963 WP_011271684.1.61726 WP_011271684.1.65220 315456.RF_1384 gi|67459776|ref|YP_247400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]