SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315749.Bcer98_2459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315749.Bcer98_2459
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.81e-50
Family Ribonuclease PH domain 1-like 0.0000177
Further Details:      
 
Domain Number 2 Region: 293-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-49
Family Ribonuclease PH domain 1-like 0.0000119
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.41e-30
Family Ribonuclease PH domain 2-like 0.0028
Further Details:      
 
Domain Number 4 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.78e-30
Family Ribonuclease PH domain 2-like 0.0000828
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.55e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 621-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.07e-21
Family Cold shock DNA-binding domain-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315749.Bcer98_2459
Sequence length 710
Comment (Bacillus cereus cytotoxis NVH 391-98)
Sequence
MSQEKQVFSIDLAGRQLTIETGQLAKQANGAVLVRYGDTAVLSTATASKEAKDVDFFPLT
VNYEERLYAVGKIPGGFIKREGRPSEKAILASRLIDRPIRPLFADGFRNEVQVVSIVMSV
DQDCSSEMAAMLGSSLALSISDIPFEGPIAGATVGRIDGEFIINPTVEQQEKSDIHLVVA
GTKDAINMVEAGADQVPEETMLEAIMFGHEEIKRLIAFQEEIVQAVGKEKMEVKLYEVDA
ELEKAVREMAEKDMHTAIQVHEKHAREDAINEVKQRVIAHYEEQEVEAEVLGQVSEILYK
IVKEEVRRLITVEKIRPDGRKSDEIRPLASEVGILPRTHGSGLFTRGQTQALSICTLGAL
GDVQILDGLGVEESKRFMHHYNFPSFSVGETRPMRGPGRREIGHGALGERALEPVIPSEK
DFPYTVRLVSEVLESNGSTSQASICGSTLAMMDAGVPLKAPVAGIAMGLVKSGEHYTILT
DIQGMEDHLGDMDFKVAGTAKGVTALQMDIKIDGLSREILEEALQQAKVGRMHILDHMLS
VIAEPRKELSEYAPKIITMTINPDKIRDVIGPSGKQINKIIEETGVKIDIEQDGTVFISS
IDQQMNEKAKKIIEDIVREVQVGEIYLGKVKRIEKFGAFVELFSGKDGLVHISELALERV
GKVEDVVKIGDEISVKVIEIDKQGRVNLSRKVLLKEEQEKEVAKEEATQE
Download sequence
Identical sequences A0A1C6X211 A7GRD7
315749.Bcer98_2459 WP_012094900.1.32677 WP_012094900.1.33299 WP_012094900.1.36161 WP_012094900.1.45271 WP_012094900.1.61991 WP_012094900.1.71811 WP_012094900.1.779 WP_012094900.1.78077 WP_012094900.1.7885 WP_012094900.1.96647 gi|152976173|ref|YP_001375690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]