SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315750.BPUM_2390 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315750.BPUM_2390
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily HCP-like 1.54e-37
Family HCP-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315750.BPUM_2390
Sequence length 217
Comment (Bacillus pumilus SAFR-032)
Sequence
MNHNEIGIEALNQGNIEKAAEAFTKAIEESPKDPVPYINFANLLSSINEFERALNFFQKA
IELDHAAAAAYYGAGNVYTLKEDFMKAKDYFEQALKAGMENSDLFYMLGQTLIKLEQPKL
AMPYLQRAIELNEDDNEARFQFGMCLANEQLLEEAVTTFTEVVTRDPQHADAFYNLGVAY
AYLEKKDEALEMLGKAIDVQPNHMLALHAQKLIQEAE
Download sequence
Identical sequences A8FFN9
gi|157693154|ref|YP_001487616.1| 315750.BPUM_2390 WP_012010724.1.28396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]