SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316055.RPE_4360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316055.RPE_4360
Domain Number 1 Region: 33-173
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-28
Family cAMP-binding domain 0.03
Further Details:      
 
Domain Number 2 Region: 175-244
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000987
Family CAP C-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316055.RPE_4360
Sequence length 249
Comment (Rhodopseudomonas palustris BisA53)
Sequence
MTRAGFVRLASPCRLRACSGWLPPMELSNVNWLQRFPSLAELAPSELTPLQGGAVAMALP
AGVTVFAPDQPCNFFILVCEGQVRVYQLDAEGNEIVLYRIGPGGMCILTTLALLADQSYS
AFAVTETPVEAIGLPAATFHDLMGRSAAFRRFVFNAQAARMADLMRVIQHVAFESIESRL
ASRLLALTSGKPELEITHQQLAAEIGTAREVVSRHLKAFEKRGWVSLGRGRVELRNAGPL
RAAAAHTGR
Download sequence
Identical sequences Q07IF0
316055.RPE_4360 gi|115526353|ref|YP_783264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]