SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_0213 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_0213
Domain Number 1 Region: 16-238
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.52e-59
Family Pseudouridine synthase RsuA/RluD 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_0213
Sequence length 240
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MSESHPEPTAMPELTAEEILARVLYRDGLMLVIDKPAGLPVHRGPKGGANLESSFEFLRY
GLPRPPVLAHRLDRDTSGCLVLGRHRKATASLGLLFKHGRISKTYWAVVEGGPIEDEGTI
ELPIGRLNAERGWWQKIDPEGQPATTKWRVLGRGDGLTWLALQPVTGRTHQLRVHSAAMG
WPIVGDNIYGNGPRFGEPTLHLHASEIVIPISRNKPPIVVTAPAPVHLHARLRGCGWNGE
Download sequence
Identical sequences Q21CU8
2005447103 316056.RPC_0213 gi|90421737|ref|YP_530107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]