SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_0469 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_0469
Domain Number 1 Region: 136-307
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-37
Family Extended AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 2 Region: 31-88
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000328
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_0469
Sequence length 352
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MPKSASDSPSLAPRRKLDRESQTQPETQVVVAFDDNRAVSSLVGPYGQNLALVERRLAVV
VDSRGNHITIAGSREGCDAARRVLDTLYELATQGHDLAQGDVEGAIRAVIAQGSLFEFDA
KPSSSAFEAINLRKRPVRARTAAQDSYIRALKRHELVFGIGPAGTGKTWLAVAHAAQLFE
RKEVDKIILTRPAVEAGERLGFLPGDLKEKVDPYLRPIYDALYDLMDSRIVEKALQSNEI
EIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGENSRMIVTGDPSQVDLPNGQT
SGLAEAAKLLDGVEGIAQVKFTAGDVIRHELVARIVAAYEGVPRPAASKNGG
Download sequence
Identical sequences Q21C42
gi|90421993|ref|YP_530363.1| 316056.RPC_0469 WP_011470952.1.69038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]