SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_0484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_0484
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-51
Family Ribonuclease PH domain 1-like 0.0000198
Further Details:      
 
Domain Number 2 Region: 294-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.48e-48
Family Ribonuclease PH domain 1-like 0.0000097
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.37e-29
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-26
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 555-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.17e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Domain Number 6 Region: 621-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.36e-19
Family Cold shock DNA-binding domain-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_0484
Sequence length 715
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MFNIHSVEIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSAKEGVDFLPLT
VDYIEKTYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFVDGWRNETQVIVTVLSH
DMENDPDILALVASSAALTLSGAPFKGPIGAARVGFINDEYVLNPTLDEMVDTQLDLVVA
GTADAVLMVESEAKELNEDIMLGAVMFGHRHFQPVVQAIIELAEKAAKEPREVAVVDESV
LEKEILGLIEPELRAAYAIPVKQDRYAAVGKAKEKVMAHYFPEGQEPQYDKLRIAGVFKE
LEAKIVRWNILDTGKRIDGRDSKTVRNIVAQVGVLPRAHGSALFTRGETQALVVTTLGTG
EDEQYIDSLSGTYKETFLLHYNFPPYSVGETGRMGGTKRREIGHGKLAWRAIHPVLPPHH
EFPYTLRVVSEITESNGSSSMASVCGASLALMDAGVPLKRPTAGIAMGLILEGERFAVLS
DILGDEDHLGDMDFKVAGTEQGITSLQMDIKIAGITEEIMKVALGQAKDGRIHILGEMSK
ALTNARAELGEYAPRIETFKIATDKIREVIGTGGKVIREIVEKTGAKVNIDDDGTVKVAS
SDGESIKAAIKWIKSIASDPELNAIYDGTVVKVMEFGAFVNFFGAKDGLVHISQLAAGRV
QKTSDVVKEGDKVKVKLLGFDDRGKTRLSMKVVDQETGEDLEAKQKAAEGATAAE
Download sequence
Identical sequences Q21C27
WP_011470967.1.69038 gi|90422008|ref|YP_530378.1| 316056.RPC_0484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]