SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_3945 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_3945
Domain Number 1 Region: 9-146
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-31
Family cAMP-binding domain 0.0074
Further Details:      
 
Domain Number 2 Region: 150-224
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.3e-20
Family CAP C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_3945
Sequence length 240
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MPTVDSSLVADLPLFAGLAAAELDAVLTDARSARVAKNAAVFRQGDEAQSFYVLLHGHVR
ASKTTAGGEQVVVRYVSPGETFGVAMAIGLQRYPATATAVEESVVLAWPAASWPRLVERF
PQLATNTLRSVGSRLQETHTRVVEMSTQQVEQRIAHALLRLAKQAGRKVENGVEIAFPIS
RQDIAQMTGSTLHTVSRLLSSWESRGLIESGRQRIVLRDPHGLVLLSEQVPGDIEPAKKI
Download sequence
Identical sequences Q20ZG5
316056.RPC_3945 gi|90425420|ref|YP_533790.1| WP_011474352.1.69038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]