SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_4423 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  316056.RPC_4423
Domain Number - Region: 8-123
Classification Level Classification E-value
Superfamily PIN domain-like 0.00016
Family PIN domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_4423
Sequence length 196
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MFANRFTALVDACTLAGALKRNLLLTLAEAEFFRLRWSACILDETQRAIEKILSDKGVPD
AADRAARARASMETAFEEAMVTDFDVFLPASGGLPDPGDAHVLAAALKIQAAMIVTDNLK
DFPENVLKRLNIEARSADEFIADTIALDPGRAVAAIRRMRERFKKPEKTAEVLLLDMEAN
GLTETVDILRAHVESL
Download sequence
Identical sequences Q20Y40
WP_011474827.1.69038 316056.RPC_4423 gi|90425895|ref|YP_534265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]