SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316057.RPD_1444 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316057.RPD_1444
Domain Number 1 Region: 9-146
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.11e-31
Family cAMP-binding domain 0.0068
Further Details:      
 
Domain Number 2 Region: 150-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.88e-22
Family CAP C-terminal domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316057.RPD_1444
Sequence length 236
Comment (Rhodopseudomonas palustris BisB5)
Sequence
MATIDASLVTKLPLFAGLTADELDAILQQARSIRVPKNANVFEQGEDAHSFFVLLHGHVR
ASKLTPAGEQVVVRYVSPGETLGVAMAIGLLNYPATATAVDDSIVLAWPTAAWPRLVEQY
PSLATNTLRTVGARLQETHSRVVEISTQQVEQRVAHALLRLAKQSGRKVANGVEIDFPIS
RQDIAQMTGTTLHTVSRLLSGWEQKGLIESGRQRIVLRNLDQLVVLADQTPDDQTS
Download sequence
Identical sequences Q13B58
WP_011501865.1.68018 316057.RPD_1444 gi|91975923|ref|YP_568582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]