SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316058.RPB_0591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316058.RPB_0591
Domain Number 1 Region: 129-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.49e-38
Family Extended AAA-ATPase domain 0.053
Further Details:      
 
Domain Number 2 Region: 28-87
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000804
Family Eukaryotic type KH-domain (KH-domain type I) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316058.RPB_0591
Sequence length 344
Comment (Rhodopseudomonas palustris HaA2)
Sequence
MSRRKPDRDSLTPPEAQPETQVVIAFDDNRAASALVGPYGQNLAQIERRLAVVVDSRGNH
ITIAGSREGCDAARRVLEALYAQAVAGNDLSQGDVDGAIRAVIAQGSLFEFDAKSTAGAF
EAINLRKRPVRARTAAQDSYIRALKRHELVFGVGPAGTGKTWLAVAHAAQLFERKEVDKI
ILTRPAVEAGERLGFLPGDLREKVDPYLRPIYDALYDLMDSRIVERALQTNEIEIAPLAF
MRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGENSRMIVTGDPSQVDLPNGQTSGLSEAV
KLLAGVEGIAQVKFTAEDVIRHELVARIVAAYEGIPPKPAGGAA
Download sequence
Identical sequences Q2J2K8
316058.RPB_0591 gi|86747717|ref|YP_484213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]