SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316058.RPB_0605 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316058.RPB_0605
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.58e-52
Family Ribonuclease PH domain 1-like 0.0000166
Further Details:      
 
Domain Number 2 Region: 294-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-49
Family Ribonuclease PH domain 1-like 0.0000101
Further Details:      
 
Domain Number 3 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-28
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.26e-26
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 555-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.43e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 621-704
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.98e-21
Family Cold shock DNA-binding domain-like 0.00063
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.06e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316058.RPB_0605
Sequence length 718
Comment (Rhodopseudomonas palustris HaA2)
Sequence
MFNKHSVEIDWGGRPLKLETGKVARQADGAVVATYGETIVLATVVAAKTPREGVDFLPLT
VDYQEKTYAAGRIPGGYFKREGRPTEKETLVSRLIDRPIRPLFADGWRNETQVIVTVLSH
DMENDPDILAMVAASAALTLSGAPFKGPIGAARVGFINDEYVLNPVLDEMPETQLELVVA
GTADAVLMVESEAKELSEEIMLGAVMFGHRHFQPVIDAIIELAEKAAKEPRELVVIDDSA
IEKEMLGLVEQELRAAYAIPVKQERYAAVGKVKEKAIAHFFPEGEEPKYDKLRIAGVFKE
LEAKIVRWNILDTGKRIDGRDSKTVRSIIAEAGVLPRAHGSALFTRGETQALVVTTLGTG
EDEQYVDSLAGTYKETFLLHYNFPPYSVGETGRLGGTKRREIGHGKLAWRAIRPVLPPHH
EFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPLKRPTAGIAMGLILEGERFAVLS
DILGDEDHLGDMDFKVAGTEQGITSLQMDIKIAGITEEIMKVALGQAKDGRIHILGEMSK
ALDRARAELGEHAPRIETFKIPTDKIREVIGTGGKVIREIVEKTGAKVNIEDDGTVKVAS
SDGESIKAAIKWIKSIASDPEVGEIYEGTVVKVMEFGAFVNFFGAKDGLVHISQLASGRV
QKTSDVVKEGDKVKVKLLGFDDRGKTRLSMRVVDQETGEDLEAKQKAEGEAPAQATGE
Download sequence
Identical sequences Q2J2J4
WP_011439506.1.50975 316058.RPB_0605 2005295098 gi|86747731|ref|YP_484227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]