SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316058.RPB_2282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316058.RPB_2282
Domain Number 1 Region: 72-132
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000437
Family Cytochrome c3-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316058.RPB_2282
Sequence length 217
Comment (Rhodopseudomonas palustris HaA2)
Sequence
MSRLRHLVLAGAAGILAACVLTIAGPVLQGEADAANPPVPGRATLRPVSDFAKIGDKDAR
AVALFEEAGKVIASPRCMNCHPAGDRPTQTDTMRPHEPLVVRGEGGHGPVGGLACNTCHH
DTNFDPARVPGHPKWALAPLEMAWQGKTLGQICVQIKDRTRNGDMDMAKLVHHMAEDDLV
GWGWNPGAGRTPAPGTQKEFGALIKAWADSGAACPKG
Download sequence
Identical sequences Q2IXS3
2005291391 gi|86749402|ref|YP_485898.1| 316058.RPB_2282 WP_011441174.1.50975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]