SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316058.RPB_2802 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316058.RPB_2802
Domain Number 1 Region: 39-163
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.1e-31
Family HSP20 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316058.RPB_2802
Sequence length 167
Comment (Rhodopseudomonas palustris HaA2)
Sequence
MNMRGMIPWGRNNQPLARAFDSDPFLSLHREMNRLFDDVFRGFDATPALSNRLAAFGNAW
PKLEIADTDKELKVAAEIPGMEEKDIEVLLDDGALTIRGEKISTTEDKTRQFSEHFYGKF
ERRIPLDVPVAADKVAAAFKNGVLTVTLPKLEPVPGTSKRIAIQPGK
Download sequence
Identical sequences Q2IWA6
WP_011441689.1.50975 316058.RPB_2802 gi|86749919|ref|YP_486415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]