SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316067.Geob_2697 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316067.Geob_2697
Domain Number 1 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-50
Family Ribonuclease PH domain 1-like 0.0000226
Further Details:      
 
Domain Number 2 Region: 293-485
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-47
Family Ribonuclease PH domain 1-like 0.0000137
Further Details:      
 
Domain Number 3 Region: 447-544
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-28
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 143-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.31e-27
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 5 Region: 551-637
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.71e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 
Domain Number 6 Region: 236-318
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.63e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0022
Further Details:      
 
Domain Number 7 Region: 617-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.14e-19
Family Cold shock DNA-binding domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316067.Geob_2697
Sequence length 696
Comment (Geobacter FRC 32)
Sequence
METKVQVECGGRTITIETGKMAKQASGAVVVSSGDTRVLVTAVATKTAKEGQDFFPLTVN
YQEKAYAGGKIPGGFFKREARPSDNETLTCRLIDRPIRPLFPDNFLNDTQIMATVISADK
DNDPGILSMVGASAALMVSDIPFQGPIAGVKVGRIDGRFVANPGFEEMEKSDIEIVVAAS
KDAIIMVEGSAAEVSEEDMLEAIFFGHAAIQGLLAAQVELAEKAGVAKREVLPPVVNEAL
KAKVKELAYSRMKEAVRIKSKVERHNTIDTITGEVLTALAEEFEGAAKEIKGFLGDFEYD
LVREHIIKDGERIDGRDTKTIRQITTEVGLLPRAHGSALFTRGETQALVVATLGTSIDEQ
RIDSLFGESKKRFLLHYNFPPFSVGETSFRLAPGRREIGHGMLAERALARVVPKHESFPY
TIRIVSDILESNGSSSMASVCGGSMSMMDAGIPIKAPVAGIAMGLIKEGDDFAILSDILG
DEDHLGDMDFKVAGTSTGVTALQMDIKIGGVTREIMGVALKQAHEGRLHILSKMAETIGT
SKAELSTFAPRITTIYVKTDKIRDVIGSGGKNIRGITEATGVTIDIDDTGKINIASTDKA
ACDMAIKMIRDLTAEAEEGKLYMGLVKKVMEFGAFVEIFPGTDGLVHISELDTERVKNVT
DVLKEGDKVLVKCIGIDKQGKIKLSRKEALGASLPE
Download sequence
Identical sequences B9M1G5
316067.Geob_2697 gi|222055786|ref|YP_002538148.1| WP_012647775.1.88144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]